Lineage for d2mska_ (2msk A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114859Protein NTRC receiver domain [52180] (1 species)
  7. 2114860Species Salmonella typhimurium [TaxId:90371] [52181] (8 PDB entries)
  8. 2114861Domain d2mska_: 2msk A: [274466]
    automated match to d1j56a_

Details for d2mska_

PDB Entry: 2msk (more details)

PDB Description: solution structure and chemical shift assignments for bef3 activated receiver domain of nitrogen regulatory protein c (ntrc) at 35c
PDB Compounds: (A:) nitrogen regulation protein nr(I)

SCOPe Domain Sequences for d2mska_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mska_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe

SCOPe Domain Coordinates for d2mska_:

Click to download the PDB-style file with coordinates for d2mska_.
(The format of our PDB-style files is described here.)

Timeline for d2mska_: