Lineage for d2msla_ (2msl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855571Protein NTRC receiver domain [52180] (1 species)
  7. 2855572Species Salmonella typhimurium [TaxId:90371] [52181] (8 PDB entries)
  8. 2855574Domain d2msla_: 2msl A: [274465]
    automated match to d1j56a_

Details for d2msla_

PDB Entry: 2msl (more details)

PDB Description: solution structure and chemical shift assignments for the apo form of the receiver domain of nitrogen regulatory protein c (ntrc) at 35c
PDB Compounds: (A:) nitrogen regulation protein nr(I)

SCOPe Domain Sequences for d2msla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2msla_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe

SCOPe Domain Coordinates for d2msla_:

Click to download the PDB-style file with coordinates for d2msla_.
(The format of our PDB-style files is described here.)

Timeline for d2msla_: