Lineage for d5bxqb_ (5bxq B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181479Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 2181501Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)
  7. 2181516Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries)
    Uniprot P61972
  8. 2181540Domain d5bxqb_: 5bxq B: [274450]
    Other proteins in same PDB: d5bxqc_, d5bxqd_, d5bxqe_
    automated match to d1gy6a_
    complexed with gdp, mg, so4

Details for d5bxqb_

PDB Entry: 5bxq (more details), 2.5 Å

PDB Description: structure of the ntf2:rangdp complex
PDB Compounds: (B:) nuclear transport factor 2

SCOPe Domain Sequences for d5bxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxqb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
hnfg

SCOPe Domain Coordinates for d5bxqb_:

Click to download the PDB-style file with coordinates for d5bxqb_.
(The format of our PDB-style files is described here.)

Timeline for d5bxqb_: