![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
![]() | Domain d5bt4c_: 5bt4 C: [274444] Other proteins in same PDB: d5bt4a2, d5bt4b2 automated match to d3u5la_ complexed with 2lo, edo |
PDB Entry: 5bt4 (more details), 1.5 Å
SCOPe Domain Sequences for d5bt4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bt4c_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lpte
Timeline for d5bt4c_:
![]() Domains from other chains: (mouse over for more information) d5bt4a1, d5bt4a2, d5bt4b1, d5bt4b2 |