| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (5 proteins) |
| Protein automated matches [190366] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187201] (31 PDB entries) |
| Domain d5bt3a_: 5bt3 A: [274440] automated match to d3i3je_ complexed with 2lo, ipa |
PDB Entry: 5bt3 (more details), 1.05 Å
SCOPe Domain Sequences for d5bt3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bt3a_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg
Timeline for d5bt3a_: