Lineage for d5bt3a_ (5bt3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706816Protein automated matches [190366] (2 species)
    not a true protein
  7. 2706817Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)
  8. 2706818Domain d5bt3a_: 5bt3 A: [274440]
    automated match to d3i3je_
    complexed with 2lo, ipa

Details for d5bt3a_

PDB Entry: 5bt3 (more details), 1.05 Å

PDB Description: crystal structure of ep300 bromodomain in complex with sgc-cbp30 chemical probe
PDB Compounds: (A:) Histone acetyltransferase p300

SCOPe Domain Sequences for d5bt3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bt3a_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivkspmdlstikrkld
tgqyqepwqyvddiwlmfnnawlynrktsrvykycsklsevfeqeidpvmqslg

SCOPe Domain Coordinates for d5bt3a_:

Click to download the PDB-style file with coordinates for d5bt3a_.
(The format of our PDB-style files is described here.)

Timeline for d5bt3a_: