Class a: All alpha proteins [46456] (286 folds) |
Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) automatically mapped to Pfam PF01392 |
Family a.141.1.0: automated matches [274414] (1 protein) not a true family |
Protein automated matches [274417] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [274420] (5 PDB entries) |
Domain d5bqcb_: 5bqc B: [274429] automated match to d1ijya_ complexed with nag, scr |
PDB Entry: 5bqc (more details), 3 Å
SCOPe Domain Sequences for d5bqcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bqcb_ a.141.1.0 (B:) automated matches {Homo sapiens [TaxId: 9606]} rrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvy vpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp gdee
Timeline for d5bqcb_: