Lineage for d5bqcb_ (5bqc B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751564Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 1751565Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 1751579Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 1751580Protein automated matches [274417] (1 species)
    not a true protein
  7. 1751581Species Homo sapiens [TaxId:9606] [274420] (5 PDB entries)
  8. 1751592Domain d5bqcb_: 5bqc B: [274429]
    automated match to d1ijya_
    complexed with nag, scr

Details for d5bqcb_

PDB Entry: 5bqc (more details), 3 Å

PDB Description: crystal structure of norrin in complex with the cysteine-rich domain of frizzled 4 and sucrose octasulfate
PDB Compounds: (B:) Frizzled-4

SCOPe Domain Sequences for d5bqcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqcb_ a.141.1.0 (B:) automated matches {Homo sapiens [TaxId: 9606]}
rrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvy
vpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
gdee

SCOPe Domain Coordinates for d5bqcb_:

Click to download the PDB-style file with coordinates for d5bqcb_.
(The format of our PDB-style files is described here.)

Timeline for d5bqcb_: