Lineage for d5bpqc_ (5bpq C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751564Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 1751565Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 1751579Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 1751580Protein automated matches [274417] (1 species)
    not a true protein
  7. 1751581Species Homo sapiens [TaxId:9606] [274420] (5 PDB entries)
  8. 1751590Domain d5bpqc_: 5bpq C: [274427]
    automated match to d1ijya_
    complexed with cl, nag

Details for d5bpqc_

PDB Entry: 5bpq (more details), 2.4 Å

PDB Description: crystal structure of the cysteine-rich domain of human frizzled 4 - crystal form ii
PDB Compounds: (C:) Frizzled-4

SCOPe Domain Sequences for d5bpqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bpqc_ a.141.1.0 (C:) automated matches {Homo sapiens [TaxId: 9606]}
cdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyvp
mctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp

SCOPe Domain Coordinates for d5bpqc_:

Click to download the PDB-style file with coordinates for d5bpqc_.
(The format of our PDB-style files is described here.)

Timeline for d5bpqc_: