| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) ![]() automatically mapped to Pfam PF01392 |
| Family a.141.1.0: automated matches [274414] (1 protein) not a true family |
| Protein automated matches [274417] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries) |
| Domain d5bpqc_: 5bpq C: [274427] automated match to d1ijya_ complexed with cl, nag |
PDB Entry: 5bpq (more details), 2.4 Å
SCOPe Domain Sequences for d5bpqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bpqc_ a.141.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyvp
mctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
Timeline for d5bpqc_: