![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
![]() | Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) ![]() automatically mapped to Pfam PF01392 |
![]() | Family a.141.1.0: automated matches [274414] (1 protein) not a true family |
![]() | Protein automated matches [274417] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries) |
![]() | Domain d5bpbc_: 5bpb C: [274423] Other proteins in same PDB: d5bpbb2 automated match to d1ijya_ complexed with nag |
PDB Entry: 5bpb (more details), 2.2 Å
SCOPe Domain Sequences for d5bpbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bpbc_ a.141.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmeg
Timeline for d5bpbc_:
![]() Domains from other chains: (mouse over for more information) d5bpba_, d5bpbb1, d5bpbb2, d5bpbd_ |