Lineage for d2rmam_ (2rma M:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806745Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 806746Superfamily b.62.1: Cyclophilin-like [50891] (4 families) (S)
  5. 806747Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 806748Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 806767Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
    Uniprot P05092
  8. 806810Domain d2rmam_: 2rma M: [27441]

Details for d2rmam_

PDB Entry: 2rma (more details), 2.1 Å

PDB Description: crystal structures of cyclophilin a complexed with cyclosporin a and n-methyl-4-[(e)-2-butenyl]-4,4-dimethylthreonine cyclosporin a
PDB Compounds: (M:) cyclophilin a

SCOP Domain Sequences for d2rmam_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmam_ b.62.1.1 (M:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d2rmam_:

Click to download the PDB-style file with coordinates for d2rmam_.
(The format of our PDB-style files is described here.)

Timeline for d2rmam_: