Lineage for d4zxgb2 (4zxg B:86-207)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999415Protein Pf GST [101210] (1 species)
    cannot be assigned to any of the known GST classes
  7. 1999416Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries)
  8. 1999422Domain d4zxgb2: 4zxg B:86-207 [274403]
    Other proteins in same PDB: d4zxga1, d4zxgb1
    automated match to d1okta1
    complexed with gol, mes, so4

Details for d4zxgb2

PDB Entry: 4zxg (more details), 1.7 Å

PDB Description: ligandin binding site of pfgst
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4zxgb2:

Sequence, based on SEQRES records: (download)

>d4zxgb2 a.45.1.1 (B:86-207) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rk

Sequence, based on observed residues (ATOM records): (download)

>d4zxgb2 a.45.1.1 (B:86-207) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkkndky
yfvgnnltyadlavfnlyddietkylknfpllkahnefisnlpniknyitnrk

SCOPe Domain Coordinates for d4zxgb2:

Click to download the PDB-style file with coordinates for d4zxgb2.
(The format of our PDB-style files is described here.)

Timeline for d4zxgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zxgb1