SCOPe 2.08: Domain d4zxgb2: 4zxg B:86-207

Lineage for d4zxgb2 (4zxg B:86-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Pf GST [101210] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries)

8. Domain d4zxgb2: 4zxg B:86-207 [274403]
   Other proteins in same PDB: d4zxga1, d4zxgb1
   automated match to d1okta1
   complexed with gol, mes, so4

Details for d4zxgb2

PDB Entry: 4zxg, 1.7 Å

PDB Description: ligandin binding site of pfgst

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4zxgb2:

Sequence, based on SEQRES records:

>d4zxgb2 a.45.1.1 (B:86-207) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rk

Sequence, based on observed residues (ATOM records):

>d4zxgb2 a.45.1.1 (B:86-207) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkkndky
yfvgnnltyadlavfnlyddietkylknfpllkahnefisnlpniknyitnrk

Timeline for d4zxgb2:

• d4zxgb2 first appeared in SCOPe 2.05
  
• d4zxgb2 appears in SCOPe 2.07