Lineage for d4zxgb1 (4zxg B:3-85)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132648Protein Pf GST [102442] (1 species)
    cannot be assigned to any of the known GST classes
  7. 2132649Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries)
  8. 2132655Domain d4zxgb1: 4zxg B:3-85 [274402]
    Other proteins in same PDB: d4zxga2, d4zxgb2
    automated match to d1okta2
    complexed with gol, mes, so4

Details for d4zxgb1

PDB Entry: 4zxg (more details), 1.7 Å

PDB Description: ligandin binding site of pfgst
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4zxgb1:

Sequence, based on SEQRES records: (download)

>d4zxgb1 c.47.1.5 (B:3-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
qigdlilaqsqaivrylskkyni

Sequence, based on observed residues (ATOM records): (download)

>d4zxgb1 c.47.1.5 (B:3-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dnivlyyfdargkaelirlifaylgieytdkrfgvdafvefknfkkekdtpfeqvpilqi
gdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d4zxgb1:

Click to download the PDB-style file with coordinates for d4zxgb1.
(The format of our PDB-style files is described here.)

Timeline for d4zxgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zxgb2