Lineage for d4z95l1 (4z95 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759844Domain d4z95l1: 4z95 L:1-107 [274400]
    Other proteins in same PDB: d4z95h_, d4z95l2
    automated match to d2v7ha1
    protein/DNA complex; complexed with po4

Details for d4z95l1

PDB Entry: 4z95 (more details), 1.79 Å

PDB Description: fab structure of antibody s1-15 in complex with ssdna dna, 5'-5(dt)-p- 3'
PDB Compounds: (L:) S1-15 Fab (IgG2b) light chain

SCOPe Domain Sequences for d4z95l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z95l1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqstsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvkvliyytsrlrsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik

SCOPe Domain Coordinates for d4z95l1:

Click to download the PDB-style file with coordinates for d4z95l1.
(The format of our PDB-style files is described here.)

Timeline for d4z95l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z95l2
View in 3D
Domains from other chains:
(mouse over for more information)
d4z95h_