Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4z95l1: 4z95 L:1-107 [274400] Other proteins in same PDB: d4z95h_, d4z95l2 automated match to d2v7ha1 protein/DNA complex; complexed with po4 |
PDB Entry: 4z95 (more details), 1.79 Å
SCOPe Domain Sequences for d4z95l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z95l1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqstsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvkvliyytsrlrsgvps rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik
Timeline for d4z95l1: