Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4z76e1: 4z76 E:1-99 [274398] Other proteins in same PDB: d4z76a1, d4z76a2, d4z76a3, d4z76b2, d4z76d1, d4z76d2, d4z76d3, d4z76e2 automated match to d1k5nb_ complexed with edo, gol, so4 |
PDB Entry: 4z76 (more details), 1.88 Å
SCOPe Domain Sequences for d4z76e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z76e1 b.1.1.2 (E:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d4z76e1: