Lineage for d4z78g2 (4z78 G:182-276)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767332Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)
  8. 1767352Domain d4z78g2: 4z78 G:182-276 [274385]
    Other proteins in same PDB: d4z78a1, d4z78b_, d4z78d1, d4z78e_, d4z78g1, d4z78h_
    automated match to d1fo0h1
    complexed with edo, gol, so4

Details for d4z78g2

PDB Entry: 4z78 (more details), 2.3 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes
PDB Compounds: (G:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4z78g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z78g2 b.1.1.0 (G:182-276) automated matches {Mus musculus [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwkp

SCOPe Domain Coordinates for d4z78g2:

Click to download the PDB-style file with coordinates for d4z78g2.
(The format of our PDB-style files is described here.)

Timeline for d4z78g2: