Lineage for d4z77a2 (4z77 A:182-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759872Domain d4z77a2: 4z77 A:182-275 [274381]
    Other proteins in same PDB: d4z77a1, d4z77a3, d4z77b1, d4z77b2, d4z77d1, d4z77d3, d4z77e1, d4z77e2
    automated match to d1fo0h1
    complexed with 15p, edo, gol, so4

Details for d4z77a2

PDB Entry: 4z77 (more details), 1.85 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4z77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z77a2 b.1.1.0 (A:182-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwk

SCOPe Domain Coordinates for d4z77a2:

Click to download the PDB-style file with coordinates for d4z77a2.
(The format of our PDB-style files is described here.)

Timeline for d4z77a2: