![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d4z77d2: 4z77 D:182-275 [274380] Other proteins in same PDB: d4z77a1, d4z77a3, d4z77b1, d4z77b2, d4z77d1, d4z77d3, d4z77e1, d4z77e2 automated match to d1fo0h1 complexed with 15p, edo, gol, so4 |
PDB Entry: 4z77 (more details), 1.85 Å
SCOPe Domain Sequences for d4z77d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z77d2 b.1.1.0 (D:182-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf qkwaavvvplgkeqnytchvhhkglpepltlrwk
Timeline for d4z77d2: