Lineage for d4z77a1 (4z77 A:0-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938107Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2938127Domain d4z77a1: 4z77 A:0-181 [274379]
    Other proteins in same PDB: d4z77a2, d4z77a3, d4z77b1, d4z77b2, d4z77d2, d4z77d3, d4z77e1, d4z77e2
    automated match to d1kj3h2
    complexed with 15p, edo, gol, so4

Details for d4z77a1

PDB Entry: 4z77 (more details), 1.85 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4z77a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z77a1 d.19.1.1 (A:0-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
mgphslryfvtavsrpglgeprfiavgyvddtqfvrfdsdadnprfeprapwmeqegpey
weeqtqraksdeqwfrvslrtaqryynqskggshtfqrmfgcdvgsdwrllrgyhqfayd
grdyialnedlktwtaadtaalitrrkweqagdaeyyraylegecvewlrrylelgnetl
lr

SCOPe Domain Coordinates for d4z77a1:

Click to download the PDB-style file with coordinates for d4z77a1.
(The format of our PDB-style files is described here.)

Timeline for d4z77a1: