SCOPe 2.07: Domain d4yoza2: 4yoz A:780-967

Lineage for d4yoza2 (4yoz A:780-967)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.0: automated matches [227298] (1 protein)
   not a true family

6. Protein automated matches [227124] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)

8. Domain d4yoza2: 4yoz A:780-967 [274377]
   Other proteins in same PDB: d4yoza3
   automated match to d2r7ga2
   complexed with so4

Details for d4yoza2

PDB Entry: 4yoz, 2.25 Å

PDB Description: p107 pocket domain in complex with hpv e7 peptide

PDB Compounds: (A:) Retinoblastoma-like protein 1,Retinoblastoma-like protein 1

SCOPe Domain Sequences for d4yoza2:

Sequence, based on SEQRES records:

>d4yoza2 a.74.1.0 (A:780-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrpkrtgslalfyrkvyhlasvrlrdlclkldvsnelrrkiwtcfeftlvhcpdlmkdrh
ldqlllcafyimakvtkeertfqeimksyrnqpqanshvyrsvllksikeergdlikfyn
tiyvgrvksfalkydlanqdhmmdapplspfp

Sequence, based on observed residues (ATOM records):

>d4yoza2 a.74.1.0 (A:780-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrpkrtgslalfyrkvyhlasvrlrdlclkldvsnelrrkiwtcfeftlvhcpdlmkdrh
ldqlllcafyimakvtkeertfqeimksyrnqpqanshvyrsvllkergdlikfyntiyv
grvksfalkyplspfp

Timeline for d4yoza2:

• d4yoza2 first appeared in SCOPe 2.05
  
• d4yoza2 appears in SCOPe 2.06
  
• d4yoza2 appears in the current release, SCOPe 2.08