![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.0: automated matches [227298] (1 protein) not a true family |
![]() | Protein automated matches [227124] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries) |
![]() | Domain d4yoza2: 4yoz A:780-967 [274377] Other proteins in same PDB: d4yoza3 automated match to d2r7ga2 complexed with so4 |
PDB Entry: 4yoz (more details), 2.25 Å
SCOPe Domain Sequences for d4yoza2:
Sequence, based on SEQRES records: (download)
>d4yoza2 a.74.1.0 (A:780-967) automated matches {Human (Homo sapiens) [TaxId: 9606]} nrpkrtgslalfyrkvyhlasvrlrdlclkldvsnelrrkiwtcfeftlvhcpdlmkdrh ldqlllcafyimakvtkeertfqeimksyrnqpqanshvyrsvllksikeergdlikfyn tiyvgrvksfalkydlanqdhmmdapplspfp
>d4yoza2 a.74.1.0 (A:780-967) automated matches {Human (Homo sapiens) [TaxId: 9606]} nrpkrtgslalfyrkvyhlasvrlrdlclkldvsnelrrkiwtcfeftlvhcpdlmkdrh ldqlllcafyimakvtkeertfqeimksyrnqpqanshvyrsvllkergdlikfyntiyv grvksfalkyplspfp
Timeline for d4yoza2: