Lineage for d4yoza2 (4yoz A:780-967)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718713Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2718714Protein automated matches [227124] (1 species)
    not a true protein
  7. 2718715Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)
  8. 2718725Domain d4yoza2: 4yoz A:780-967 [274377]
    Other proteins in same PDB: d4yoza3
    automated match to d2r7ga2
    complexed with so4

Details for d4yoza2

PDB Entry: 4yoz (more details), 2.25 Å

PDB Description: p107 pocket domain in complex with hpv e7 peptide
PDB Compounds: (A:) Retinoblastoma-like protein 1,Retinoblastoma-like protein 1

SCOPe Domain Sequences for d4yoza2:

Sequence, based on SEQRES records: (download)

>d4yoza2 a.74.1.0 (A:780-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrpkrtgslalfyrkvyhlasvrlrdlclkldvsnelrrkiwtcfeftlvhcpdlmkdrh
ldqlllcafyimakvtkeertfqeimksyrnqpqanshvyrsvllksikeergdlikfyn
tiyvgrvksfalkydlanqdhmmdapplspfp

Sequence, based on observed residues (ATOM records): (download)

>d4yoza2 a.74.1.0 (A:780-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrpkrtgslalfyrkvyhlasvrlrdlclkldvsnelrrkiwtcfeftlvhcpdlmkdrh
ldqlllcafyimakvtkeertfqeimksyrnqpqanshvyrsvllkergdlikfyntiyv
grvksfalkyplspfp

SCOPe Domain Coordinates for d4yoza2:

Click to download the PDB-style file with coordinates for d4yoza2.
(The format of our PDB-style files is described here.)

Timeline for d4yoza2: