Lineage for d4yoza1 (4yoz A:391-594)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003956Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 2003957Protein automated matches [227124] (1 species)
    not a true protein
  7. 2003958Species Human (Homo sapiens) [TaxId:9606] [226765] (8 PDB entries)
  8. 2003975Domain d4yoza1: 4yoz A:391-594 [274376]
    Other proteins in same PDB: d4yoza3
    automated match to d1n4ma1
    complexed with so4

Details for d4yoza1

PDB Entry: 4yoz (more details), 2.25 Å

PDB Description: p107 pocket domain in complex with hpv e7 peptide
PDB Compounds: (A:) Retinoblastoma-like protein 1,Retinoblastoma-like protein 1

SCOPe Domain Sequences for d4yoza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yoza1 a.74.1.0 (A:391-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqsvsrlqsivaglknapsdqlinifescvrnpvenimkilkgigetfcqhytqstdeqp
gshidfavnrlklaeilyykiletvmvqetrrlhgmdmsvlleqdifhrslmaccleivl
fayssprtfpwiievlnlqpfyfykvievvirseeglsrdmvkhlnsieeqileslawsh
dsalwealqvsankvptceevifp

SCOPe Domain Coordinates for d4yoza1:

Click to download the PDB-style file with coordinates for d4yoza1.
(The format of our PDB-style files is described here.)

Timeline for d4yoza1: