Lineage for d4yefe1 (4yef E:76-156)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765993Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 2766028Protein automated matches [190844] (1 species)
    not a true protein
  7. 2766029Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries)
  8. 2766036Domain d4yefe1: 4yef E:76-156 [274371]
    Other proteins in same PDB: d4yefb2, d4yefe2
    automated match to d1z0mb_
    complexed with glu, gol, so4

Details for d4yefe1

PDB Entry: 4yef (more details), 1.72 Å

PDB Description: beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin
PDB Compounds: (E:) 5'-AMP-activated protein kinase subunit beta-1

SCOPe Domain Sequences for d4yefe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yefe1 b.1.18.21 (E:76-156) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qarptvfrwtgggkevylsgsfnnwsklpltrsqnnfvaildlpegehqykffvdgqwth
dpsepivtsqlgtvnniiqvk

SCOPe Domain Coordinates for d4yefe1:

Click to download the PDB-style file with coordinates for d4yefe1.
(The format of our PDB-style files is described here.)

Timeline for d4yefe1: