![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
![]() | Protein automated matches [190844] (1 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries) |
![]() | Domain d4yefd_: 4yef D: [274369] Other proteins in same PDB: d4yefb2, d4yefe2 automated match to d1z0mb_ complexed with glu, gol, so4 |
PDB Entry: 4yef (more details), 1.72 Å
SCOPe Domain Sequences for d4yefd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yefd_ b.1.18.21 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptvfrwtgggkevylsgsfnnwsklpltrsqnnfvaildlpegehqykffvdgqwthdps epivtsqlgtvnniiqv
Timeline for d4yefd_: