SCOPe 2.08: Domain d4yefb1: 4yef B:76-156

Lineage for d4yefb1 (4yef B:76-156)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein automated matches [190844] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries)

8. Domain d4yefb1: 4yef B:76-156 [274367]
   Other proteins in same PDB: d4yefb2, d4yefe2
   automated match to d1z0mb_
   complexed with glu, gol, so4

Details for d4yefb1

PDB Entry: 4yef, 1.72 Å

PDB Description: beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin

PDB Compounds: (B:) 5'-AMP-activated protein kinase subunit beta-1

SCOPe Domain Sequences for d4yefb1:

Sequence; same for both SEQRES and ATOM records:

>d4yefb1 b.1.18.21 (B:76-156) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qarptvfrwtgggkevylsgsfnnwsklpltrsqnnfvaildlpegehqykffvdgqwth
dpsepivtsqlgtvnniiqvk

Timeline for d4yefb1:

• d4yefb1 first appeared in SCOPe 2.05, called d4yefb_
  
• d4yefb1 appears in SCOPe 2.07