Lineage for d4xshb_ (4xsh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000735Species Bacillus cereus [TaxId:1396] [274205] (3 PDB entries)
  8. 3000737Domain d4xshb_: 4xsh B: [274360]
    Other proteins in same PDB: d4xsha_
    automated match to d3bw8a_
    complexed with edo, gsp, mg, nai

Details for d4xshb_

PDB Entry: 4xsh (more details), 2.5 Å

PDB Description: the complex structure of c3cer exoenzyme and gtp bound rhoa (nadh- bound state)
PDB Compounds: (B:) ADP-ribosyltransferase

SCOPe Domain Sequences for d4xshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xshb_ d.166.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
kyklctnkeeadawgkkqfnkwskeeksairdytknarpyneflrmhagkldsdptmkkk
iesldkalnrkeakvndnikvyrgddawifgkeydnsiikngkvdrekfkeiqkkfqgkt
ttefgyistsilidagyaktrpvmtefkvgsgthgaymnsddltaypgqyelllprntvy
kiekiyiaidnntqkeqikveatik

SCOPe Domain Coordinates for d4xshb_:

Click to download the PDB-style file with coordinates for d4xshb_.
(The format of our PDB-style files is described here.)

Timeline for d4xshb_: