SCOPe 2.05: Domain d4xsgb_: 4xsg B:

Lineage for d4xsgb_ (4xsg B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [274205] (3 PDB entries)

8. Domain d4xsgb_: 4xsg B: [274359]
   Other proteins in same PDB: d4xsga_
   automated match to d3bw8a_
   complexed with edo, gsp, mg

Details for d4xsgb_

PDB Entry: 4xsg, 1.8 Å

PDB Description: the complex structure of c3cer exoenzyme and gtp bound rhoa (nadh-free state)

PDB Compounds: (B:) ADP-ribosyltransferase

SCOPe Domain Sequences for d4xsgb_:

Sequence; same for both SEQRES and ATOM records:

>d4xsgb_ d.166.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
kyklctnkeeadawgkkqfnkwskeeksairdytknarpyneflrmhagkldsdptmkkk
iesldkalnrkeakvndnikvyrgddawifgkeydnsiikngkvdrekfkeiqkkfqgkt
ttefgyistsilidagyaktrpvmtefkvgsgthgaymnsddltaypgqyelllprntvy
kiekiyiaidnntqkeqikveatik

Timeline for d4xsgb_:

• d4xsgb_ is new in SCOPe 2.05-stable
  
• d4xsgb_ appears in SCOPe 2.06
  
• d4xsgb_ appears in the current release, SCOPe 2.08