Lineage for d4xjja_ (4xjj A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962325Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 1962328Species Human (Homo sapiens) [TaxId:9606] [69952] (7 PDB entries)
  8. 1962330Domain d4xjja_: 4xjj A: [274358]
    automated match to d1m9za_
    complexed with 41d

Details for d4xjja_

PDB Entry: 4xjj (more details), 1.4 Å

PDB Description: extracellular domain of type ii transforming growth factor beta receptor in complex with 2-(2-hydroxyethyl)ndsb-201
PDB Compounds: (A:) TGF-beta receptor type-2

SCOPe Domain Sequences for d4xjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xjja_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
alckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklpy
hdfiledaasptcimkekkkpgetffmcscssdecndniifseey

SCOPe Domain Coordinates for d4xjja_:

Click to download the PDB-style file with coordinates for d4xjja_.
(The format of our PDB-style files is described here.)

Timeline for d4xjja_: