Lineage for d4xchd_ (4xch D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2237971Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 2237972Protein Autoinducer-2 production protein LuxS [64295] (5 species)
    S-ribosylhomocysteinase
  7. 2238000Species Streptococcus suis [TaxId:1307] [274352] (1 PDB entry)
  8. 2238004Domain d4xchd_: 4xch D: [274354]
    automated match to d1j6wa_
    complexed with zn

Details for d4xchd_

PDB Entry: 4xch (more details), 2.2 Å

PDB Description: s-ribosylhomocysteinase from streptococcus suis
PDB Compounds: (D:) S-ribosylhomocysteine lyase

SCOPe Domain Sequences for d4xchd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xchd_ d.185.1.2 (D:) Autoinducer-2 production protein LuxS {Streptococcus suis [TaxId: 1307]}
ldhtivkapyirliseevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqri
dglidcspfgcrtgfhmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnyk
dhslhsakewaklilsqgistdaferkpi

SCOPe Domain Coordinates for d4xchd_:

Click to download the PDB-style file with coordinates for d4xchd_.
(The format of our PDB-style files is described here.)

Timeline for d4xchd_: