Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein) contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1) automatically mapped to Pfam PF02664 |
Protein Autoinducer-2 production protein LuxS [64295] (5 species) S-ribosylhomocysteinase |
Species Streptococcus suis [TaxId:1307] [274352] (1 PDB entry) |
Domain d4xchb_: 4xch B: [274353] automated match to d1j6wa_ complexed with zn |
PDB Entry: 4xch (more details), 2.2 Å
SCOPe Domain Sequences for d4xchb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xchb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Streptococcus suis [TaxId: 1307]} ldhtivkapyirliseevgpkgdiitnfdirliqpnenamdtaglhtiehllaklirqri dglidcspfgcrtgfhmimwgkqdsekiaqvikssleeiaegitwedvpgttiescgnyk dhslhsakewaklilsqgistdaferkpi
Timeline for d4xchb_: