Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries) |
Domain d4wcoc_: 4wco C: [274339] automated match to d1hyrb_ complexed with act, so4, zn |
PDB Entry: 4wco (more details), 2.46 Å
SCOPe Domain Sequences for d4wcoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wcoc_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} acpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsdhwi glsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsks
Timeline for d4wcoc_: