Lineage for d4up2d_ (4up2 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131390Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. 2131391Species Escherichia coli [TaxId:562] [159703] (7 PDB entries)
    Uniprot P0A853 5-471! Uniprot Q8XB34 5-471
  8. 2131400Domain d4up2d_: 4up2 D: [274333]
    automated match to d2c44a1
    complexed with bme, so4

Details for d4up2d_

PDB Entry: 4up2 (more details), 2.78 Å

PDB Description: crystal structure of escherichia coli tryptophanase purified from alkaline stressed bacterial culture.
PDB Compounds: (D:) tryptophanase

SCOPe Domain Sequences for d4up2d_:

Sequence, based on SEQRES records: (download)

>d4up2d_ c.67.1.2 (D:) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]}
enfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtq
smqaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqek
gldrskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergie
evgpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqr
eaeykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvq
egfptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaaf
vdagkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrlt
ipratytqthmdfiieafkhvkenasnikgltf

Sequence, based on observed residues (ATOM records): (download)

>d4up2d_ c.67.1.2 (D:) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]}
enfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtq
smqaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqek
gldrskmvafsnyfvrnvyikeafdtgvrydfkgnfdleglergieevgpnnvpyivati
tsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreaeykdwtieqitr
etykyadmlamsakkdamvpmggllcmkddsfleggamerlavglydgmnldwlayriaq
vqylvdgleeigvvcqqagghaafvdagkllphipadqfpaqalacelykvagiraveel
lrltipratytqthmdfiieafkhvkenasnikgltf

SCOPe Domain Coordinates for d4up2d_:

Click to download the PDB-style file with coordinates for d4up2d_.
(The format of our PDB-style files is described here.)

Timeline for d4up2d_: