Lineage for d4unqb_ (4unq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866327Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 2866341Domain d4unqb_: 4unq B: [274327]
    automated match to d1w2ga_
    complexed with h6d, na

Details for d4unqb_

PDB Entry: 4unq (more details), 2.3 Å

PDB Description: mtb tmk in complex with compound 36
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4unqb_:

Sequence, based on SEQRES records: (download)

>d4unqb_ c.37.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatlap

Sequence, based on observed residues (ATOM records): (download)

>d4unqb_ c.37.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelardaelqqrtgavyaelaaqgwggrwlvvgadvdp
grlaatlap

SCOPe Domain Coordinates for d4unqb_:

Click to download the PDB-style file with coordinates for d4unqb_.
(The format of our PDB-style files is described here.)

Timeline for d4unqb_: