SCOPe 2.06: Domain d4udtb2: 4udt B:115-243

Lineage for d4udtb2 (4udt B:115-243)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4udtb2: 4udt B:115-243 [274320]
   Other proteins in same PDB: d4udta2
   automated match to d3q5ya2
   complexed with gol

Details for d4udtb2

PDB Entry: 4udt, 1.35 Å

PDB Description: t cell receptor (trav22,trbv7-9) structure

PDB Compounds: (B:) protein trbv7-9, T-cell receptor beta-2 chain c region

SCOPe Domain Sequences for d4udtb2:

Sequence; same for both SEQRES and ATOM records:

>d4udtb2 b.1.1.0 (B:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d4udtb2:

• d4udtb2 first appeared in SCOPe 2.05
  
• d4udtb2 appears in SCOPe 2.07
  
• d4udtb2 appears in the current release, SCOPe 2.08