Lineage for d4udtb2 (4udt B:115-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754366Domain d4udtb2: 4udt B:115-243 [274320]
    Other proteins in same PDB: d4udta2
    automated match to d3q5ya2
    complexed with gol

Details for d4udtb2

PDB Entry: 4udt (more details), 1.35 Å

PDB Description: t cell receptor (trav22,trbv7-9) structure
PDB Compounds: (B:) protein trbv7-9, T-cell receptor beta-2 chain c region

SCOPe Domain Sequences for d4udtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4udtb2 b.1.1.0 (B:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d4udtb2:

Click to download the PDB-style file with coordinates for d4udtb2.
(The format of our PDB-style files is described here.)

Timeline for d4udtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4udtb1