Lineage for d4ugua_ (4ugu A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941879Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1941880Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1941881Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1942574Protein automated matches [190421] (5 species)
    not a true protein
  7. 1942580Species Bacillus subtilis [TaxId:224308] [228529] (39 PDB entries)
  8. 1942590Domain d4ugua_: 4ugu A: [274307]
    automated match to d4uqra_
    complexed with cl, gol, h4b, hem, pqw

Details for d4ugua_

PDB Entry: 4ugu (more details), 1.8 Å

PDB Description: structure of bacillus subtilis nitric oxide synthase in complex with n'-(4-(((2s,4r)-4-(3-((c-thiophen-2-ylcarbonimidoyl)amino)phenoxy) pyrrolidin-2-yl)methoxy)phenyl)thiophene-2-carboximidamide
PDB Compounds: (A:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d4ugua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ugua_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

SCOPe Domain Coordinates for d4ugua_:

Click to download the PDB-style file with coordinates for d4ugua_.
(The format of our PDB-style files is described here.)

Timeline for d4ugua_: