Lineage for d4ugla_ (4ugl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2610000Protein automated matches [190421] (6 species)
    not a true protein
  7. 2610006Species Bacillus subtilis [TaxId:224308] [228529] (75 PDB entries)
  8. 2610035Domain d4ugla_: 4ugl A: [274301]
    automated match to d4uqra_
    complexed with cl, gol, h4b, hem, s90

Details for d4ugla_

PDB Entry: 4ugl (more details), 1.82 Å

PDB Description: structure of bacillus subtilis nitric oxide synthase in complex with n1-(3-(2-(6-amino-4-methylpyridin-2-yl)ethyl)-5-fluorophenyl)-n1- cyclopropyl-n2-methylethane-1,2-diamine
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d4ugla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ugla_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

SCOPe Domain Coordinates for d4ugla_:

Click to download the PDB-style file with coordinates for d4ugla_.
(The format of our PDB-style files is described here.)

Timeline for d4ugla_: