SCOPe 2.05: Domain d4udta1: 4udt A:2-113

Lineage for d4udta1 (4udt A:2-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens, [TaxId:9606] [268390] (3 PDB entries)

8. Domain d4udta1: 4udt A:2-113 [274299]
   Other proteins in same PDB: d4udta2
   automated match to d4eura1
   complexed with gol

Details for d4udta1

PDB Entry: 4udt, 1.35 Å

PDB Description: t cell receptor (trav22,trbv7-9) structure

PDB Compounds: (A:) t cell receptor alpha chain, T-cell receptor alpha chain c region

SCOPe Domain Sequences for d4udta1:

Sequence; same for both SEQRES and ATOM records:

>d4udta1 b.1.1.0 (A:2-113) automated matches {Homo sapiens, [TaxId: 9606]}
giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrls
attvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlan

Timeline for d4udta1:

• d4udta1 is new in SCOPe 2.05-stable
  
• d4udta1 appears in SCOPe 2.06
  
• d4udta1 appears in the current release, SCOPe 2.08