Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Homo sapiens, [TaxId:9606] [268390] (3 PDB entries) |
Domain d4udta1: 4udt A:2-113 [274299] Other proteins in same PDB: d4udta2 automated match to d4eura1 complexed with gol |
PDB Entry: 4udt (more details), 1.35 Å
SCOPe Domain Sequences for d4udta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4udta1 b.1.1.0 (A:2-113) automated matches {Homo sapiens, [TaxId: 9606]} giqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrls attvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlan
Timeline for d4udta1: