SCOPe 2.05: Domain d4ug8a_: 4ug8 A:

Lineage for d4ug8a_ (4ug8 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228529] (39 PDB entries)

8. Domain d4ug8a_: 4ug8 A: [274292]
   automated match to d4uqra_
   complexed with cl, gol, h4b, hem, hw1

Details for d4ug8a_

PDB Entry: 4ug8, 1.89 Å

PDB Description: structure of bacillus subtilis nitric oxide synthase in complex with 6-(5-((3r,4r)-4-((6-azanyl-4-methyl-pyridin-2-yl)methyl)pyrrolidin-3- yl)oxypentyl)-4-methyl-pyridin-2-amine

PDB Compounds: (A:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d4ug8a_:

Sequence; same for both SEQRES and ATOM records:

>d4ug8a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
eekeilwneakafiaacyqelgkaaevkdrladikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkeevrdalfhhietatnngkirptitifppeekgek
qveiwnhqliryagyesdgerigdpascsltaaceelgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigiaadyntdlwkdqalvelnkavlhsykkqgvsivd
hhtaasqfkrfeeqaeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

Timeline for d4ug8a_:

• d4ug8a_ is new in SCOPe 2.05-stable
  
• d4ug8a_ appears in SCOPe 2.06
  
• d4ug8a_ appears in the current release, SCOPe 2.08