Lineage for d4udua1 (4udu A:3-113)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2028019Domain d4udua1: 4udu A:3-113 [274290]
    Other proteins in same PDB: d4udua2, d4uduc1, d4uduc2
    automated match to d4eura1
    complexed with na, zn

Details for d4udua1

PDB Entry: 4udu (more details), 2.5 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (A:) t cell receptor alpha chain, T-cell receptor alpha chain c region

SCOPe Domain Sequences for d4udua1:

Sequence, based on SEQRES records: (download)

>d4udua1 b.1.1.0 (A:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlan

Sequence, based on observed residues (ATOM records): (download)

>d4udua1 b.1.1.0 (A:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
ttvaterysllyisssqttdsgvyfcavdsaykyifgtgtrlkvlan

SCOPe Domain Coordinates for d4udua1:

Click to download the PDB-style file with coordinates for d4udua1.
(The format of our PDB-style files is described here.)

Timeline for d4udua1: