SCOPe 2.05: Domain d4uduc1: 4udu C:10-120

Lineage for d4uduc1 (4udu C:10-120)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (7 PDB entries)

8. Domain d4uduc1: 4udu C:10-120 [274288]
   Other proteins in same PDB: d4udua1, d4udua2, d4udub1, d4udub2, d4uduc2
   automated match to d1esfa1
   complexed with na, zn

Details for d4uduc1

PDB Entry: 4udu, 2.5 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor

PDB Compounds: (C:) enterotoxin type e

SCOPe Domain Sequences for d4uduc1:

Sequence, based on SEQRES records:

>d4uduc1 b.40.2.0 (C:10-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftghpwyndllv
dlgskdatnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records):

>d4uduc1 b.40.2.0 (C:10-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqrnalsnlrqiyyynekaitenkesntllfkgfftghpwyndllvdlgskd
atnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Timeline for d4uduc1:

• d4uduc1 is new in SCOPe 2.05-stable
  
• d4uduc1 appears in SCOPe 2.06
  
• d4uduc1 appears in the current release, SCOPe 2.08