Lineage for d4uduc1 (4udu C:10-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2382641Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2382642Protein automated matches [226834] (5 species)
    not a true protein
  7. 2382643Species Staphylococcus aureus [TaxId:1280] [225054] (9 PDB entries)
  8. 2382660Domain d4uduc1: 4udu C:10-120 [274288]
    Other proteins in same PDB: d4udua1, d4udua2, d4udub1, d4udub2, d4uduc2
    automated match to d1esfa1
    complexed with na, zn

Details for d4uduc1

PDB Entry: 4udu (more details), 2.5 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (C:) enterotoxin type e

SCOPe Domain Sequences for d4uduc1:

Sequence, based on SEQRES records: (download)

>d4uduc1 b.40.2.0 (C:10-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftghpwyndllv
dlgskdatnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

Sequence, based on observed residues (ATOM records): (download)

>d4uduc1 b.40.2.0 (C:10-120) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdlrkkselqrnalsnlrqiyyynekaitenkesntllfkgfftghpwyndllvdlgskd
atnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt

SCOPe Domain Coordinates for d4uduc1:

Click to download the PDB-style file with coordinates for d4uduc1.
(The format of our PDB-style files is described here.)

Timeline for d4uduc1: