Lineage for d4s2sl2 (4s2s L:114-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. 2752752Domain d4s2sl2: 4s2s L:114-217 [274279]
    Other proteins in same PDB: d4s2sa_, d4s2sb1, d4s2sh_, d4s2sl1
    automated match to d4bz1l2

Details for d4s2sl2

PDB Entry: 4s2s (more details), 2.1 Å

PDB Description: crystal structure of fab fragment of monoclonal antibody roab13
PDB Compounds: (L:) RoAb13 Fab Light chain

SCOPe Domain Sequences for d4s2sl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2sl2 b.1.1.2 (L:114-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4s2sl2:

Click to download the PDB-style file with coordinates for d4s2sl2.
(The format of our PDB-style files is described here.)

Timeline for d4s2sl2: