Lineage for d4s2sb1 (4s2s B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760249Domain d4s2sb1: 4s2s B:1-113 [274276]
    Other proteins in same PDB: d4s2sa_, d4s2sb2, d4s2sh_, d4s2sl2
    automated match to d4bz1l1

Details for d4s2sb1

PDB Entry: 4s2s (more details), 2.1 Å

PDB Description: crystal structure of fab fragment of monoclonal antibody roab13
PDB Compounds: (B:) RoAb13 Fab Light chain

SCOPe Domain Sequences for d4s2sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2sb1 b.1.1.0 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsvgekvtmsckssqsllyrgnqmnylawyqqkpgqspklliywastr
esgvpdrftgsgsgteftltissvkaedltvyycqqyytyprtfgggtkleik

SCOPe Domain Coordinates for d4s2sb1:

Click to download the PDB-style file with coordinates for d4s2sb1.
(The format of our PDB-style files is described here.)

Timeline for d4s2sb1: