| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4s2sb1: 4s2s B:1-113 [274276] Other proteins in same PDB: d4s2sa_, d4s2sb2, d4s2sh_, d4s2sl2 automated match to d4bz1l1 |
PDB Entry: 4s2s (more details), 2.1 Å
SCOPe Domain Sequences for d4s2sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s2sb1 b.1.1.0 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsvgekvtmsckssqsllyrgnqmnylawyqqkpgqspklliywastr
esgvpdrftgsgsgteftltissvkaedltvyycqqyytyprtfgggtkleik
Timeline for d4s2sb1:
View in 3DDomains from other chains: (mouse over for more information) d4s2sa_, d4s2sh_, d4s2sl1, d4s2sl2 |