SCOPe 2.08: Domain d4tqia_: 4tqi A:

Lineage for d4tqia_ (4tqi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d4tqia_: 4tqi A: [274274]
   automated match to d1f41a_
   complexed with 6bd, gol

Details for d4tqia_

PDB Entry: 4tqi, 1.25 Å

PDB Description: human transthyretin (ttr) complexed with 3-(9h-fluoren-9- ylideneaminooxy)propanoic acid in a dual binding mode

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d4tqia_:

Sequence; same for both SEQRES and ATOM records:

>d4tqia_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d4tqia_:

• d4tqia_ first appeared in SCOPe 2.05
  
• d4tqia_ appears in SCOPe 2.07