Lineage for d4rxya_ (4rxy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883287Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [274265] (2 PDB entries)
  8. 2883288Domain d4rxya_: 4rxy A: [274266]
    automated match to d2a8dd_
    complexed with gol, zn

Details for d4rxya_

PDB Entry: 4rxy (more details), 1.9 Å

PDB Description: crystal structure of the beta carbonic anhydrase psca3 isolated from pseudomonas aeruginosa
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d4rxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rxya_ c.53.2.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dlqqlfennvrwaeaikqedpdffaklarqqtpeylwigcsdarvpaneivgmlpgdlfv
hrnvanvvlhtdlnclsviqfavdvlkvkhilvtghygcggvraslhndqlglidgwlrs
irdlayeyrehleqlpteeervdrlcelnviqqvanvshtsivqnawhrgqslsvhgciy
gikdglwknlnvtvsgldqlppqyrlspl

SCOPe Domain Coordinates for d4rxya_:

Click to download the PDB-style file with coordinates for d4rxya_.
(The format of our PDB-style files is described here.)

Timeline for d4rxya_: