Class b: All beta proteins [48724] (149 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (2 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) |
Protein Cyclophilin (eukaryotic) [50893] (10 species) |
Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (45 PDB entries) |
Domain d1cwja_: 1cwj A: [27425] complexed with mnv, tbm |
PDB Entry: 1cwj (more details), 1.8 Å
SCOP Domain Sequences for d1cwja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwja_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A} mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d1cwja_: