SCOP 1.71: Domain d1cwja_: 1cwj A:

Lineage for d1cwja_ (1cwj A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (2 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (10 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (45 PDB entries)

8. Domain d1cwja_: 1cwj A: [27425]
   complexed with mnv, tbm

Details for d1cwja_

PDB Entry: 1cwj, 1.8 Å

PDB Description: human cyclophilin a complexed with 2-val 3-s-methyl-sarcosine cyclosporin

SCOP Domain Sequences for d1cwja_:

Sequence; same for both SEQRES and ATOM records:

>d1cwja_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1cwja_:

• d1cwja_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwja_ appears in SCOP 1.69
  
• d1cwja_ appears in SCOP 1.73
  
• d1cwja_ appears in the current release, SCOPe 2.08