Lineage for d4qnkf1 (4qnk F:10-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931148Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries)
  8. 2931162Domain d4qnkf1: 4qnk F:10-95 [274249]
    Other proteins in same PDB: d4qnka2, d4qnkb2, d4qnkc2, d4qnkd2, d4qnke2, d4qnkf2, d4qnkg2, d4qnkh2
    automated match to d4mu3a1
    complexed with edo, mn, na, po4

Details for d4qnkf1

PDB Entry: 4qnk (more details), 1.75 Å

PDB Description: the structure of wt a. thaliana igpd2 in complex with mn2+ and phosphate
PDB Compounds: (F:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4qnkf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnkf1 d.14.1.0 (F:10-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
arigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdth
iddhhtnedvalaigtallkalgerk

SCOPe Domain Coordinates for d4qnkf1:

Click to download the PDB-style file with coordinates for d4qnkf1.
(The format of our PDB-style files is described here.)

Timeline for d4qnkf1: